Update app.py

app.py

@@ -26,6 +26,9 @@ from alphafold.model import data
 from alphafold.model import config
 from alphafold.model import model
 
+data = {'id': [], 'sequence': [],'length': []}
+
+sequencesdf = pd.DataFrame.from_dict(data)
 
 def update_seqs(choice):
     return gr.Textbox.update(choice)
@@ -123,7 +126,9 @@ def update_protGPT2(inp, length):
     generated_seqs = run_protgpt2(startsequence, seqlen)
     gen_seqs = [x["generated_text"] for x in generated_seqs]
     print(gen_seqs)
-    return gr.Radio.update(gen_seqs)
+    data = {'id': range(len(gen_seqs), 'sequence': gen_seqs,'length': [len(x) for x in gen_seqs]}
+    sequencesdf = pd.DataFrame.from_dict(data)
+    return sequencesdf
 
 
 def update(inp):
@@ -312,6 +317,8 @@ def molecule(pdb):
     allow-top-navigation-by-user-activation allow-downloads" allowfullscreen="" 
     allowpaymentrequest="" frameborder="0" srcdoc='{x}'></iframe>"""
 
+def change_sequence(chosenSeq):
+    return chosenSeq
 
 proteindream = gr.Blocks()
 
@@ -333,14 +340,10 @@ with proteindream:
             length = gr.Number(value=50, label="Target sequence length")
         btn = gr.Button("Predict sequences using protGPT2")
 
-    seqs = []
-    #        "MTAEADPAPLAANPPAPVRPIQFHDVSVRYEARPWLRALWDVASGSFIGLLGASGAGKSTCVDLLNGVRKPSSGERFVRGQPSRGRKGRFNRRVAMVFQDVRHQLFSRSVAREIAFGLENLPTSAAAIDRRVS",
-    #        "MTAGIVAGGIAGGVAGYKAKKHRKAVKATMIAAGVSGGIGGGYIGEKFNRRLAKHEDRVRRSAPRHKKHSSYSKSSGEGGGILGKLFGR",
-    #        "MTAVLVAIALEMQNPHRMALAAVLCGQFTVAVAAEPFAPEGVAEGLNPLGDLLAESPLLEVVSATLALLVALGTATSLSWISGPVSALPAPSFQSSETPYPQRPIERESFDQDSREEDPWDRL",
-    #        "MTARVRNRSSSRSYVLDFADLADGQREVLLPESRGNASEVDLPAGTTVNVTIDVTASGTGTLTARTPDGADVVSNEYELTVERDTDLTRVETESPQVAAGETATVTGTAENVGTVAGEREVTAYVDGE",
-    #        "MTAAGWREEGTPFARIARQLGRHVTSVRQAAGRVRQQMGLTSPDPADPPRSGPTPTIPIEQERA",
-    seqChoice = gr.Radio(seqs, label="Generated sequences")
-    btn.click(fn=update_protGPT2, inputs=[inp, length], outputs=seqChoice)
+    results = gr.Dataframe(sequences, label="Results", headers=["id","sequence", "length"])
+    seqChoice = gr.Radio(["sequence 1", "sequence 2", "sequence 3","sequence 4","sequence 5"], label="Choose a sequence")
+    btn.click(fn=update_protGPT2, inputs=[inp, length], outputs=results)
+    seqChoice.change(fn=chosenSeq, inputs=seqChoice, outputs=chosenSeq)
     gr.Markdown("## AlphaFold")
     gr.Markdown(
         "Select a generated sequence above for structure prediction using AlphaFold2."
@@ -355,7 +358,7 @@ with proteindream:
             plot = gr.Plot(label="pLDDT")
     gr.Markdown(
         """## Acknowledgements
-         This was a fun demo using Gradio, Huggingface and ColabFold. More information about the used algorithms can be found below. 
+         This was a fun demo using Gradio, Huggingface Spaces and ColabFold as inspiration. More information about the used algorithms can be found below. 
 
          All code is available on [Github]() and licensed under MIT license.